DPM1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051818

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051818 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

83 

Antigen sequence

SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFS
ESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD
 

Matching transcripts

DPM1-001 - ENSP00000360644 [100%]
DPM1-003 - ENSP00000360640 [100%]
DPM1-004 - ENSP00000394921 [100%]
DPM1-005 - ENSP00000360638 [100%]
DPM1-201 - ENSP00000360639 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

33.2, 32.4, 29.6, 28.8, 25.1 

Antibody dilution

1:140 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1100 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DPM1-001
 
DPM1-003
 
DPM1-004
 
DPM1-005
 
DPM1-201