FGR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002024

 

Antibody CAB018959

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA002024 2670.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

147  

Antigen sequence

VFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNY
SNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEK
FHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQAEEWYFGKIG
 
 

Matching transcripts

FGR-001 - ENSP00000363117 [100%]
FGR-002 - ENSP00000363115 [100%]
FGR-004 - ENSP00000363116 [100%]
FGR-007 - ENSP00000407670 [100%]
FGR-201 - ENSP00000382126 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human tonsil shows selective cytoplasmic positivity in subsets of lymphoid cells.
More information
 Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:400 1:250 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.5, 34.7 59.5, 52.2, 34.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
FGR-001
 
FGR-002
 
FGR-004
 
FGR-007
 
FGR-201