LAS1L

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044431

 

Antibody HPA061463

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044431 HPA061463 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

143 86 

Antigen sequence

GPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVAWLSRAEWDQVTVY
LFCDDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLLDVTGGLG
TDELRLLYGMALVRFVNLISERKTKFAKVPLKCLAQEVNIPDW
 
VRWDTFPLGRMPGQTEDPAELMLENYDTMYLLDQPVLEQRLEPSTCKTDT
LGLSCGVGSGNCSNSSSSNFEGLLWSQGQLHGLKTG
 

Matching transcripts

LAS1L-003 - ENSP00000363944 [100%]
LAS1L-004 - ENSP00000363940 [100%]
LAS1L-005 - ENSP00000473471 [100%]
LAS1L-201 - ENSP00000308649 [100%]
 LAS1L-001 - ENSP00000363937 [100%]
LAS1L-003 - ENSP00000363944 [100%]
LAS1L-004 - ENSP00000363940 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human bronchus shows strong cytoplasmic and membranous positivity in respiratory epithelial cells.
More information
 Immunohistochemical staining of human kidney shows strong nuclear positivity in renal tubules and renal glomeruli.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:1100 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm, microtubule organizing center & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:23  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.1, 81.2, 33.1 83.1, 81.2, 76.8 

Antibody dilution

1:250 1:370 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:4450 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LAS1L-001
 
LAS1L-003
 
LAS1L-004
 
LAS1L-005
 
LAS1L-201