ARHGAP33

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030117

 

Antibody HPA030118

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030117 HPA030118 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

84 70 

Antigen sequence

PPYLPRQQSDGSLLRSQRPMGTSRRGLRGPAQVSAQLRAGGGGRDAPEAA
AQSPCSVPSQVPTPGFFSPAPRECLPPFLGVPKP
 
PSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGL
LRTFMRSRPSRQRLRQRGIL
 

Matching transcripts

ARHGAP33-002 - ENSP00000320038 [100%]
ARHGAP33-009 - ENSP00000466443 [100%]
ARHGAP33-201 - ENSP00000007510 [100%]
 ARHGAP33-001 - ENSP00000368227 [100%]
ARHGAP33-002 - ENSP00000320038 [100%]
ARHGAP33-201 - ENSP00000007510 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human adrenal gland shows cytoplasmic positivity in cortical cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:175 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & actin filaments.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:200 1:79 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

137.2, 121.1, 90.3 137.2, 121.1, 119.8 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGAP33-001
 
ARHGAP33-002
 
ARHGAP33-009
 
ARHGAP33-201