CALCR

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028962

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028962 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

116 

Antigen sequence

AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNR
TWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPEN
NRTWSNYTMCNAFTPE
 

Matching transcripts

CALCR-001 - ENSP00000399552 [100%]
CALCR-002 - ENSP00000377959 [100%]
CALCR-003 - ENSP00000391369 [100%]
CALCR-004 - ENSP00000413179 [100%]
CALCR-005 - ENSP00000389295 [100%]
CALCR-201 - ENSP00000352561 [100%]
CALCR-202 - ENSP00000353385 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity(granular pattern) in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:60 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419772)
More information
 

Target mass (kDa)

59.4, 57.3, 55.3, 34.4, 32.4 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CALCR-001
 
CALCR-002
 
CALCR-003
 
CALCR-004
 
CALCR-005
 
CALCR-201
 
CALCR-202