BZRAP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024662

 

Antibody HPA025244

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA024662 HPA025244 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

109 93 

Antigen sequence

DPGAMEPWALPTWHSWTPGRGGEPSSAAPSIADTPPAALQLQELRSEESS
KPKGDGSSRPVGGTDPEGAEACLPSLGQQASSSGPACQRPEDEEVEAFLK
AKLNMSFGD
 
RTASTSTLGEKDPGPAAPSLAKQEAEWTAGEACPASSSTQGARAQQAPNT
EMCQGGDPGSGLRPRAEKEDTAELGVHLVNSLVDHGRNSDLSD
 

Matching transcripts

BZRAP1-001 - ENSP00000268893 [100%]
BZRAP1-002 - ENSP00000345824 [100%]
BZRAP1-201 - ENSP00000347929 [100%]
 BZRAP1-001 - ENSP00000268893 [100%]
BZRAP1-002 - ENSP00000345824 [100%]
BZRAP1-009 - ENSP00000462710 [100%]
BZRAP1-201 - ENSP00000347929 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity tubular cells.
More information
 Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:40 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli & mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in aggresome.
More information
 

Antibody dilution

1:200 1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

205.0, 200.0, 193.5 205.0, 200.0, 193.5, 31.5 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BZRAP1-001
 
BZRAP1-002
 
BZRAP1-009
 
BZRAP1-201