ABCB4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049395

 

Antibody HPA053288

 

Antibody CAB004498

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA049395 HPA053288 sc-13131 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

11 11 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

83 51  

Antigen sequence

HSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLF
RHSTQKNLKNSQMCQKSLDVETDGLEANVPPVS
 
LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQ
D
 
 

Matching transcripts

ABCB4-001 - ENSP00000352135 [100%]
ABCB4-002 - ENSP00000265723 [100%]
ABCB4-009 - ENSP00000392983 [100%]
ABCB4-201 - ENSP00000351172 [100%]
ABCB4-202 - ENSP00000437465 [100%]
 ABCB4-001 - ENSP00000352135 [100%]
ABCB4-002 - ENSP00000265723 [100%]
ABCB4-003 - ENSP00000394511 [100%]
ABCB4-009 - ENSP00000392983 [100%]
ABCB4-201 - ENSP00000351172 [100%]
ABCB4-202 - ENSP00000437465 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong luminal membranous positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes.
More information
 Immunohistochemical staining of human liver shows strong luminal membranous positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:20 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

141.5, 140.7, 135.3 141.5, 140.7, 135.3, 6.9 141.5, 140.7, 135.3, 11.1, 6.9 

Antibody dilution

1:240 1:150 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1900 1:1150  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
ABCB4-001
 
ABCB4-002
 
ABCB4-003
 
ABCB4-009
 
ABCB4-201
 
ABCB4-202