MATK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004847

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004847 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

147 

Antigen sequence

GTQCITKCEHTRPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGL
LAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLFLVRES
ARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHY
 

Matching transcripts

MATK-001 - ENSP00000378485 [100%]
MATK-002 - ENSP00000378481 [100%]
MATK-003 - ENSP00000308734 [100%]
MATK-004 - ENSP00000468030 [100%]
MATK-006 - ENSP00000467006 [85%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells as well as cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:20 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408299)
More information
 

Target mass (kDa)

56.8, 56.5, 56.3, 51.9, 19.6 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
MATK-001
 
MATK-002
 
MATK-003
 
MATK-004
 
MATK-006