CDK11A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA025061

 

Antibody CAB010467

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA025061 sc-928 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

101  

Antigen sequence

YRREDSMEDRGEEDDSLAIKPPQQMSWKEKVHHRKDEKRKEKCRHHSHSA
EGGKHARVKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRL
E
 
 

Matching transcripts

CDK11A-001 - ENSP00000384442 [99%]
CDK11A-002 - ENSP00000462289 [99%]
CDK11A-008 - ENSP00000348529 [99%]
CDK11A-026 - ENSP00000422149 [99%]
CDK11A-027 - ENSP00000367905 [99%]
CDK11A-004 - ENSP00000351629 [88%]
CDK11A-005 - ENSP00000367900 [88%]
CDK11A-003 - ENSP00000350403 [84%]
CDK11A-201 - ENSP00000367902 [83%]
CDK11A-007 - ENSP00000423900 [82%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows strong nuclear and cytoplasmic positivity in purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:25 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

91.4, 91.0, 90.0, 86.8, 50.4, 49.0, 27.9, 18.9 91.4, 91.0, 90.0, 86.8, 50.4, 49.0, 27.9, 18.9, 4.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus & cytoplasm.
More information
  

Antibody dilution

1:50  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CDK11A-001
 
CDK11A-002
 
CDK11A-003
 
CDK11A-004
 
CDK11A-005
 
CDK11A-007
 
CDK11A-008
 
CDK11A-026
 
CDK11A-027
 
CDK11A-201