BTK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001198

 

Antibody HPA002028

 

Antibody CAB016689

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 AbFrontier
 

Product name

HPA001198 HPA002028 LF-MA0191  

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Ammonium Sulfate Precipitation 

Released in version

2 2 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

146 136  

Antigen sequence

PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRAR
DKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFI
VRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
 
CVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLY
VFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNA
MGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQIL
 
 

Matching transcripts

BTK-006 - ENSP00000308176 [100%]
BTK-201 - ENSP00000361971 [97%]
 BTK-006 - ENSP00000308176 [100%]
BTK-201 - ENSP00000361971 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction center.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and moderate staining was observed in lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human lymph node shows cytoplasmic and membranous positivity in lymphoid cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:100 1:350 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in vesicles.
More information
   

Antibody dilution

1:40   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

76.3, 55.9 76.3, 55.9 76.3, 55.9 

Antibody dilution

1:500 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
BTK-006
 
BTK-201