LARS2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035951

 

Antibody HPA045450

 

Antibody HPA066085

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035951 HPA045450 HPA066085 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 11 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

91 85 81 

Antigen sequence

PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQ
YGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT
 
VIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVEKWWHQRIKEQASKI
SEADKSKPKFYVLSMFPYPSGKLHMGHVRVYTISD
 
GCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLPEWYGIKGMQAHWI
GDCVGCHLDFTLKVHGQATGEKLTAYTATPE
 

Matching transcripts

LARS2-001 - ENSP00000265537 [100%]
LARS2-002 - ENSP00000408576 [100%]
LARS2-003 - ENSP00000412893 [100%]
 LARS2-001 - ENSP00000265537 [100%]
LARS2-002 - ENSP00000408576 [100%]
LARS2-005 - ENSP00000401388 [100%]
 LARS2-001 - ENSP00000265537 [100%]
LARS2-002 - ENSP00000408576 [100%]
LARS2-003 - ENSP00000412893 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.
More information
 Immunohistochemical staining of human gallbladder shows cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:30 1:10  

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done Not done  

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

  1:47 

Validation IF

  Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414602)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414602)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

102.0, 96.9 102.0, 13.4 102.0, 96.9 

Antibody dilution

1:125 1:250 1:100 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:8000 1:1850 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
LARS2-001
 
LARS2-002
 
LARS2-003
 
LARS2-005