ACPP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004335

 

Antibody CAB000071

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA004335 A0627 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

3 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

124  

Antigen sequence

QLLYLPFRNCPRFQELESETLKSEEFQKRLHPYKDFIATLGKLSGLHGQD
LFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHK
QKEKSRLQGGVLVNEILNHMKRAT
 
 

Matching transcripts

ACPP-001 - ENSP00000337471 [100%]
ACPP-003 - ENSP00000323036 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 None 

Antibody dilution

1:500 1:3000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

48.3, 44.6 48.3, 44.6, 40.4, 19.0, 11.3 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
ACPP-001
 
ACPP-003