MATR3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036564

 

Antibody HPA036565

 

Antibody CAB033552

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA036564 HPA036565 sc-55723 

Host species

Rabbit Rabbit Goat 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

7 7 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

90 89  

Antigen sequence

VVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQ
AAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKF
 
LKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGP
SLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDD
 
 

Matching transcripts

MATR3-001 - ENSP00000378279 [100%]
MATR3-002 - ENSP00000378284 [100%]
MATR3-003 - ENSP00000422319 [100%]
MATR3-008 - ENSP00000423587 [100%]
MATR3-009 - ENSP00000426743 [100%]
MATR3-010 - ENSP00000426030 [100%]
MATR3-012 - ENSP00000421218 [100%]
MATR3-013 - ENSP00000423533 [100%]
MATR3-036 - ENSP00000422054 [100%]
MATR3-201 - ENSP00000354346 [100%]
MATR3-034 - ENSP00000422649 [96%]
 MATR3-001 - ENSP00000378279 [100%]
MATR3-002 - ENSP00000378284 [100%]
MATR3-003 - ENSP00000422319 [100%]
MATR3-009 - ENSP00000426743 [100%]
MATR3-011 - ENSP00000423290 [100%]
MATR3-013 - ENSP00000423533 [100%]
MATR3-201 - ENSP00000354346 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human gall bladder shows strong niclear positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:30 1:250 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

100.0, 94.6, 88.4, 62.6, 56.7, 37.7, 13.8 100.0, 94.6, 88.4, 48.2 100.0, 94.6, 88.4, 62.6, 56.7, 48.2, 37.7, 21.3, 18.9, 13.8, 13.5, 11.8, 11.0, 10.2, 10.1, 9.2, 8.9, 8.7, 7.9, 7.1, 4.9, 1.0, 0.7 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

 1:34  

Validation IF

 Supportive: The subcellular location is supported by literature.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
MATR3-001
 
MATR3-002
 
MATR3-003
 
MATR3-008
 
MATR3-009
 
MATR3-010
 
MATR3-011
 
MATR3-012
 
MATR3-013
 
MATR3-034
 
MATR3-036
 
MATR3-201
 
 »