RUFY3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA022952

 

Antibody HPA022970

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA022952 HPA022970 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

83 113 

Antigen sequence

MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISL
TPDPEPTHEDPNYLMANERMNLMNMAKLSIKGL
 
MLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSR
LEEKTNQMAATIKQLEQRLRQAERSRQSAELDNRLFKQDFGDKINSLQLE
VEELTRQRNQLEL
 

Matching transcripts

RUFY3-001 - ENSP00000226328 [100%]
RUFY3-002 - ENSP00000370394 [100%]
 RUFY3-002 - ENSP00000370394 [100%]
RUFY3-003 - ENSP00000425400 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong positivity in neurons.
More information
 Immunohistochemical staining of human cerebral cortex shows strong positivity in neurons.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:125 1:125 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

70.6, 53.0 70.6, 64.7 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

 1:100 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
RUFY3-001
 
RUFY3-002
 
RUFY3-003