GPR124

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA012393

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA012393 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

109 

Antigen sequence

SPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTSAAPLSEAGRAGQRRS
ASRDSLKGGGALEKESHRRSYPLNAASLNGAPKGGKYDDVTLMGAEVASG
GCMKTGLWK
 

Matching transcripts

GPR124-001 - ENSP00000406367 [100%]
GPR124-002 - ENSP00000323508 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong membranous positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

142.6, 119.9 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
GPR124-001
 
GPR124-002