HSF2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031455

 

Antibody CAB016067

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA031455 sc-13517 

Host species

Rabbit Rat 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

7 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

106  

Antigen sequence

LGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDSENKGLETTKNN
VVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSE
VLSSVD
 
 

Matching transcripts

HSF2-201 - ENSP00000400380 [100%]
HSF2-002 - ENSP00000357440 [85%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows moderate nuclear positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows distinct nuclear positivity in spermatogonia.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:50 1:75 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

60.3, 58.3 60.3, 58.3 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
HSF2-002
 
HSF2-201