VIM

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001762

 

Antibody CAB000080

 

Antibody CAB058687

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 Atlas Antibodies
 

Product name

HPA001762 M7020 AMAb90516 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

2 1 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein Recombinant protein 

Length (aa)

113   

Antigen sequence

FANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQ
LTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNA
SLARLDLERKVES
 
 
 

Matching transcripts

VIM-001 - ENSP00000224237 [100%]
VIM-002 - ENSP00000435613 [100%]
VIM-201 - ENSP00000446007 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human duodenum shows distinct positivity in mesenchymal and lymphoid cells.
More information
 Immunohistochemical staining of human lymph node shows strong nuclear positivity in lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human small intestine shows strong positivity in mesenchymal and lymphoid cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 HIER pH6 

Antibody dilution

1:1000 1:400 1:5000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

53.7, 49.7 53.7, 49.7, 26.9, 20.0 53.7, 49.7, 26.9, 20.0 

Antibody dilution

1:250 1:750 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in cytoskeleton.
More information
   

Antibody dilution

1:74   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
VIM-001
 
VIM-002
 
VIM-201