IFNGR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029213

 

Antibody HPA063871

 

Antibody CAB004444

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA029213 HPA063871 sc-28363 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 14 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

126 72  

Antigen sequence

WVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHP
SVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEI
QCQLAIPVSSLNSQYCVSAEGVLHVW
 
SSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDA
CINISHHYCNISDHVGDPSNSL
 
 

Matching transcripts

IFNGR1-001 - ENSP00000356713 [100%]
IFNGR1-201 - ENSP00000443282 [100%]
IFNGR1-002 - ENSP00000389249 [98%]
 IFNGR1-001 - ENSP00000356713 [100%]
IFNGR1-201 - ENSP00000443282 [100%]
IFNGR1-003 - ENSP00000394230 [97%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows moderate positivity in cells in tubules.
More information
 Immunohistochemical staining of human lung shows moderate positivity in macrophages.
More information
 Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:450 1:15 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly not consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & vesicles.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:50   

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400147)
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.4, 31.0, 23.7 54.4, 31.0, 18.6 54.4, 31.0, 23.7, 18.6 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:2550  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
IFNGR1-001
 
IFNGR1-002
 
IFNGR1-003
 
IFNGR1-201