SNX1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047373

 

Antibody HPA052761

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA047373 HPA052761 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

65 64 

Antigen sequence

GGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVV
SKHQSPKITTSLLPI
 
NNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPP
QEATNSSKPQPTYE
 

Matching transcripts

SNX1-001 - ENSP00000453785 [100%]
SNX1-002 - ENSP00000453567 [100%]
SNX1-003 - ENSP00000261889 [100%]
SNX1-005 - ENSP00000369638 [100%]
SNX1-006 - ENSP00000452759 [100%]
SNX1-201 - ENSP00000326668 [100%]
SNX1-009 - ENSP00000452668 [98%]
SNX1-007 - ENSP00000452852 [95%]
 SNX1-001 - ENSP00000453785 [100%]
SNX1-003 - ENSP00000261889 [100%]
SNX1-201 - ENSP00000326668 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:75  

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HeLa shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 

Antibody dilution

1:30 1:38 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.1, 59.1, 53.3, 51.8, 13.6, 11.4, 11.1, 10.5 63.1, 59.1, 53.3 

Antibody dilution

1:150 1:190 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1200 1:1500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SNX1-001
 
SNX1-002
 
SNX1-003
 
SNX1-005
 
SNX1-006
 
SNX1-007
 
SNX1-009
 
SNX1-201