ARNTL2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA059074

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA059074 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

55 

Antigen sequence

RIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEER
NSKKD
 

Matching transcripts

ARNTL2-001 - ENSP00000266503 [100%]
ARNTL2-002 - ENSP00000442438 [100%]
ARNTL2-003 - ENSP00000438545 [100%]
ARNTL2-004 - ENSP00000379238 [100%]
ARNTL2-005 - ENSP00000312247 [100%]
ARNTL2-006 - ENSP00000261178 [100%]
ARNTL2-007 - ENSP00000445836 [100%]
ARNTL2-008 - ENSP00000400185 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human hippocampus shows strong nuclear membranous positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:300 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli.
More information
 

Antibody dilution

1:74 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

70.9, 69.2, 67.2, 66.5, 65.6, 61.8, 60.4 

Antibody dilution

1:240 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2950 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ARNTL2-001
 
ARNTL2-002
 
ARNTL2-003
 
ARNTL2-004
 
ARNTL2-005
 
ARNTL2-006
 
ARNTL2-007
 
ARNTL2-008