GRN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008763

 

Antibody HPA028747

 

Antibody CAB019394

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA008763 HPA028747 2632.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 6 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

144 138  

Antigen sequence

DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTR
CITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSG
KYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLL
 
SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQG
PHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGC
CPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL
 
 

Matching transcripts

GRN-001 - ENSP00000053867 [100%]
 GRN-001 - ENSP00000053867 [100%]
GRN-003 - ENSP00000465673 [100%]
GRN-002 - ENSP00000467616 [93%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:100 1:600 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:27 1:50 1:150 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.5 63.5, 46.8, 41.2 63.5, 46.8, 41.2, 20.3, 19.8, 18.1, 17.1, 15.6, 14.9, 14.3, 14.1, 11.7, 11.5, 6.6, 3.8 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GRN-001
 
GRN-002
 
GRN-003