SH3YL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030926

 

Antibody HPA030927

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030926 HPA030927 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

69 69 

Antigen sequence

FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQ
AEDLYEILDSFTEKYENEG
 
MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAIL
SVIKAGFLVTARGGSGIVV
 

Matching transcripts

SH3YL1-001 - ENSP00000348471 [100%]
SH3YL1-002 - ENSP00000384276 [100%]
SH3YL1-003 - ENSP00000384269 [100%]
SH3YL1-005 - ENSP00000383928 [100%]
SH3YL1-009 - ENSP00000441266 [100%]
SH3YL1-011 - ENSP00000385668 [100%]
SH3YL1-201 - ENSP00000404143 [100%]
 SH3YL1-001 - ENSP00000348471 [100%]
SH3YL1-002 - ENSP00000384276 [100%]
SH3YL1-003 - ENSP00000384269 [100%]
SH3YL1-004 - ENSP00000384910 [100%]
SH3YL1-019 - ENSP00000399519 [99%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and extracellular positivity in cells of tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:50 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

37.1, 34.9, 27.4, 25.1, 17.3 37.1, 34.9, 24.6, 11.8 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus.
More information
 

Antibody dilution

 1:5 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
SH3YL1-001
 
SH3YL1-002
 
SH3YL1-003
 
SH3YL1-004
 
SH3YL1-005
 
SH3YL1-009
 
SH3YL1-011
 
SH3YL1-019
 
SH3YL1-201