CDH1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004812

 

Antibody CAB000087

 

Antibody CAB028364

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 ECM Biosciences
 

Product name

HPA004812 13-1700 CM1681 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G 

Released in version

3 1 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein 

Length (aa)

125   

Antigen sequence

ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIID
ADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKIN
LKLMDNQNKDQVTTLEVSVCDCEGA
 
 
 

Matching transcripts

CDH1-001 - ENSP00000261769 [100%]
CDH1-004 - ENSP00000414946 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 HIER pH6 

Antibody dilution

1:50 1:2500 1:450 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

97.5, 90.9 97.5, 90.9, 59.4, 45.5, 17.5 97.5, 90.9, 59.4, 45.5, 17.5 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane, focal adhesion sites & aggresome.
More information
  Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & Golgi apparatus.
More information
 

Antibody dilution

1:24  1:112 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CDH1-001
 
CDH1-004