CTNS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046947

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046947 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

55 

Antigen sequence

FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFG
DPTKF
 

Matching transcripts

CTNS-001 - ENSP00000046640 [100%]
CTNS-002 - ENSP00000371294 [100%]
CTNS-201 - ENSP00000395471 [100%]
CTNS-202 - ENSP00000411465 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 

Antibody dilution

1:9 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.0, 41.7, 33.2, 25.3 

Antibody dilution

1:90 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:700 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CTNS-001
 
CTNS-002
 
CTNS-201
 
CTNS-202