LCP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036396

 

Antibody HPA036397

 

Antibody CAB004574

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA036396 HPA036397 sc-13151 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

7 7 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

81 97  

Antigen sequence

GARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFP
EETESHEEDNGGWSSFEEDDYESPNDDQDGE
 
PNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSG
KTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKT
 
 

Matching transcripts

LCP2-001 - ENSP00000046794 [100%]
 LCP2-001 - ENSP00000046794 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in Megakaryocytes.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:50 1:150 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Testis
More information
 

Target mass (kDa)

60.2 60.2 60.2, 36.8, 15.6 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
LCP2-001