LTBP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005707

 

Antibody HPA006221

 

Antibody CAB025428

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA005707 HPA006221 MAB388 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

94 141  

Antigen sequence

EKCPLPGTAKEEPVEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTK
LEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSS
 
DHKHCRDIDECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDID
ECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVC
QRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECEHPGLCG
 
 

Matching transcripts

LTBP1-001 - ENSP00000385359 [100%]
LTBP1-008 - ENSP00000384373 [100%]
LTBP1-007 - ENSP00000384091 [94%]
LTBP1-014 - ENSP00000386043 [94%]
LTBP1-204 - ENSP00000393057 [94%]
LTBP1-018 - ENSP00000417591 [92%]
LTBP1-202 - ENSP00000346467 [92%]
LTBP1-203 - ENSP00000374653 [92%]
 LTBP1-001 - ENSP00000385359 [100%]
LTBP1-007 - ENSP00000384091 [100%]
LTBP1-008 - ENSP00000384373 [100%]
LTBP1-014 - ENSP00000386043 [100%]
LTBP1-201 - ENSP00000272273 [100%]
LTBP1-202 - ENSP00000346467 [100%]
LTBP1-203 - ENSP00000374653 [100%]
LTBP1-204 - ENSP00000393057 [100%]
LTBP1-017 - ENSP00000388154 [96%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & cytoplasm.
More information
   

Antibody dilution

1:30   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

186.9, 186.8, 153.0, 152.9, 148.4, 147.2, 147.0, 23.5 186.9, 186.8, 153.0, 152.9, 148.4, 147.2, 147.0, 68.8, 28.8 186.9, 186.8, 153.0, 152.9, 148.4, 147.2, 147.0, 68.8, 29.3, 28.8, 23.5, 23.2, 10.9 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunohistochemistry

Image

   

Description

 Immunohistochemical staining of human bronchus shows positivity in collagen.
More information
 Immunohistochemical staining of human skin shows positivity in fibroblasts.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:200 1:800 

Validation IH

 Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
LTBP1-001
 
LTBP1-007
 
LTBP1-008
 
LTBP1-014
 
LTBP1-017
 
LTBP1-018
 
LTBP1-201
 
LTBP1-202
 
LTBP1-203
 
LTBP1-204