ELN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018111

 

Antibody HPA056941

 

Antibody CAB010750

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA018111 HPA056941 E4013 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

135 72  

Antigen sequence

VKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGA
FAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGV
AGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGA
 
VGGLGVPGVGGLGGIPPAAAAKAAKYGAAGLGGVLGGAGQFPLGGVAARP
GFGLSPIFPGGACLGKACGRKR
 
 

Matching transcripts

ELN-001 - ENSP00000313565 [100%]
ELN-002 - ENSP00000252034 [100%]
ELN-003 - ENSP00000389857 [100%]
ELN-005 - ENSP00000392575 [100%]
ELN-006 - ENSP00000369936 [100%]
ELN-007 - ENSP00000369949 [100%]
ELN-009 - ENSP00000403162 [100%]
ELN-010 - ENSP00000349540 [100%]
ELN-011 - ENSP00000391129 [100%]
ELN-013 - ENSP00000369950 [100%]
ELN-201 - ENSP00000351807 [100%]
ELN-015 - ENSP00000406949 [93%]
ELN-008 - ENSP00000369958 [90%]
ELN-004 - ENSP00000315607 [82%]
 ELN-001 - ENSP00000313565 [100%]
ELN-002 - ENSP00000252034 [100%]
ELN-004 - ENSP00000315607 [100%]
ELN-005 - ENSP00000392575 [100%]
ELN-006 - ENSP00000369936 [100%]
ELN-009 - ENSP00000403162 [100%]
ELN-013 - ENSP00000369950 [100%]
ELN-201 - ENSP00000351807 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human skin shows distinct positivity in extracellular fibers.
More information
 Immunohistochemical staining of human testis shows distinct positivity in extracellular fibers.
More information
 Immunohistochemical staining of human skin shows distinct positivity in extracellular fibers.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:125 1:850 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

69.0, 66.1, 63.2, 62.6, 61.9, 61.6, 61.2, 61.0, 60.7, 59.9, 58.8, 56.5, 55.6, 26.2 69.0, 66.1, 63.2, 62.6, 61.9, 61.0, 60.7, 55.6 69.0, 66.1, 63.2, 62.6, 61.9, 61.6, 61.2, 61.0, 60.7, 59.9, 58.8, 56.5, 55.6, 48.9, 26.2, 19.3, 15.7, 15.2, 14.7, 13.8, 6.8, 5.2 

Antibody dilution

1:250 1:210 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
ELN-001
 
ELN-002
 
ELN-003
 
ELN-004
 
ELN-005
 
ELN-006
 
ELN-007
 
ELN-008
 
ELN-009
 
ELN-010
 
ELN-011
 
ELN-013
 
ELN-015
 
ELN-201
 
 »