CDK14

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015267

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015267 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

124 

Antigen sequence

DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFE
KPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADS
YEKLEKLGEGSYATVYKGKSKVNG
 

Matching transcripts

CDK14-001 - ENSP00000369390 [100%]
CDK14-002 - ENSP00000265741 [94%]
CDK14-003 - ENSP00000385034 [90%]
CDK14-007 - ENSP00000393616 [90%]
CDK14-008 - ENSP00000394570 [90%]
CDK14-010 - ENSP00000410770 [90%]
CDK14-011 - ENSP00000406848 [90%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:20 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

1:21 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

53.1, 50.7, 47.8, 14.1 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CDK14-001
 
CDK14-002
 
CDK14-003
 
CDK14-007
 
CDK14-008
 
CDK14-010
 
CDK14-011