U2AF2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041943

 

Antibody HPA043562

 

Antibody CAB010910

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA041943 HPA043562 U4758 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

100 92  

Antigen sequence

LTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAG
QIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEA
 
PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAF
CEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS
 
 

Matching transcripts

U2AF2-001 - ENSP00000388475 [100%]
U2AF2-002 - ENSP00000307863 [100%]
U2AF2-007 - ENSP00000466167 [85%]
 U2AF2-002 - ENSP00000307863 [100%]
U2AF2-001 - ENSP00000388475 [98%]
U2AF2-008 - ENSP00000466935 [98%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

 Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong nuclear positivity in cells of tubules.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:70 1:700 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus but excluded from the nucleoli.
More information
  Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:69  1:175 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

53.5, 53.1, 9.5 53.5, 53.1, 33.9 53.5, 53.1, 33.9, 9.5, 5.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
U2AF2-001
 
U2AF2-002
 
U2AF2-007
 
U2AF2-008