MYLK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031677

 

Antibody CAB009628

 

Antibody CAB020789

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 SDIX
 

Product name

HPA031677 sc-25428 3218.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Affinity 

Released in version

8 3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Genetic immunization 

Length (aa)

145   

Antigen sequence

KCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTES
DATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPIT
CTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVE
 
 
 

Matching transcripts

MYLK-001 - ENSP00000354004 [100%]
MYLK-003 - ENSP00000320622 [100%]
MYLK-004 - ENSP00000418335 [100%]
MYLK-202 - ENSP00000352088 [100%]
MYLK-203 - ENSP00000353452 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human prostate shows distinct positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1500 1:35 1:550 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

   

Target mass (kDa)

210.7, 205.1, 203.1 210.7, 205.1, 203.1, 80.4, 25.3, 17.0, 16.8, 7.5 210.7, 205.1, 203.1, 80.4, 25.3, 17.0, 16.8, 7.5 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

   

Description

  Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

  1:137 

Validation IF

  Supportive: The subcellular location is supported by literature. 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
MYLK-001
 
MYLK-003
 
MYLK-004
 
MYLK-202
 
MYLK-203