IDH3G

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000425

 

Antibody HPA002017

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000425 HPA002017 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

114 147 

Antigen sequence

FDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKS
IANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDI
GGQGTTSEAIQDVI
 
ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYAN
VIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITK
AKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA
 

Matching transcripts

IDH3G-005 - ENSP00000217901 [100%]
IDH3G-006 - ENSP00000400115 [90%]
IDH3G-007 - ENSP00000408529 [83%]
IDH3G-014 - ENSP00000359110 [83%]
 IDH3G-003 - ENSP00000401862 [100%]
IDH3G-005 - ENSP00000217901 [100%]
IDH3G-007 - ENSP00000408529 [100%]
IDH3G-008 - ENSP00000359111 [100%]
IDH3G-014 - ENSP00000359110 [100%]
IDH3G-010 - ENSP00000402747 [84%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows granular cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding dissimilar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & mitochondria.
More information
 

Antibody dilution

1:69 1:30 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.8, 41.5, 35.4, 22.7 42.8, 41.5, 37.1, 35.4, 31.4, 22.4 

Antibody dilution

1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
IDH3G-003
 
IDH3G-005
 
IDH3G-006
 
IDH3G-007
 
IDH3G-008
 
IDH3G-010
 
IDH3G-014