ROCK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007567

 

Antibody HPA045639

 

Antibody CAB004562

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA007567 HPA045639 sc-17794 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 10 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

140 30  

Antigen sequence

TQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARG
LLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRR
ENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERT
 
KEDLICPCKVSYDVTSARDMLLLACSQDEQ
 
 

Matching transcripts

ROCK1-001 - ENSP00000382697 [100%]
 ROCK1-001 - ENSP00000382697 [100%]
ROCK1-003 - ENSP00000462004 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
More information
 Immunohistochemical staining of human bone marrow shows distinct positivity in megakaryocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:15 1:35 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

158.2 158.2, 11.3 158.2, 11.3 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ROCK1-001
 
ROCK1-003