ACSL4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000286

 

Antibody HPA005552

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000286 HPA005552 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

119 150 

Antigen sequence

EAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAINKA
EYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSGSTGRPK
GVMMHHSNLIAGMTGQCER
 
MNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNF
PLVTLYATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHI
IYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIV
 

Matching transcripts

ACSL4-001 - ENSP00000262835 [100%]
ACSL4-003 - ENSP00000419171 [100%]
ACSL4-201 - ENSP00000339787 [100%]
 ACSL4-001 - ENSP00000262835 [100%]
ACSL4-003 - ENSP00000419171 [100%]
ACSL4-201 - ENSP00000339787 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in golgi apparatus.
More information
  

Antibody dilution

1:50  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

79.2, 74.4 79.2, 74.4 

Antibody dilution

1:500 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:1000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:100 

Validation IH

 Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
ACSL4-001
 
ACSL4-003
 
ACSL4-201