MAST4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000544

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000544 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

108 

Antigen sequence

PEKQESHQKSHGPGSDLENFALFKLEEREKKVYPKAVERSSTFENKASMQ
EAPPLGSLLKDALHKQASVRASEGAMSDGPVPAEHRQGGGDFRRAPAPGT
LQDGLCHS
 

Matching transcripts

MAST4-001 - ENSP00000385727 [99%]
MAST4-002 - ENSP00000384313 [99%]
MAST4-003 - ENSP00000384099 [99%]
MAST4-004 - ENSP00000400551 [99%]
MAST4-007 - ENSP00000261569 [99%]
MAST4-201 - ENSP00000385048 [99%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

284.4, 284.1, 266.2, 265.4, 264.8, 179.9 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MAST4-001
 
MAST4-002
 
MAST4-003
 
MAST4-004
 
MAST4-007
 
MAST4-201