BCL3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047514

 

Antibody CAB002051

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA047514 NCL-Bcl-3 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

89  

Antigen sequence

AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRR
VIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN
 
 

Matching transcripts

BCL3-001 - ENSP00000164227 [100%]
BCL3-005 - ENSP00000393731 [82%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:25 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

47.6, 32.4 47.6, 32.4 

Antibody dilution

1:100 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HeLa shows positivity in cytoplasm, cytokinetic bridge & nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:91  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
BCL3-001
 
BCL3-005