DAPP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046074

 

Antibody CAB033822

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA046074 sc-67166 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

80  

Antigen sequence

HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFY
LCAKTGVEADEWIKILRWKLSQIRKQLNQG
 
 

Matching transcripts

DAPP1-002 - ENSP00000423602 [100%]
DAPP1-001 - ENSP00000296414 [88%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lung shows moderate membranous positivity in pneumocytes.
More information
 Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in a fraction of non-germinial center cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:125 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

32.2, 30.2 32.2, 30.2 

Antibody dilution

1:120 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:950  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
DAPP1-001
 
DAPP1-002