ASNS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004924

 

Antibody HPA029318

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004924 HPA029318 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

126 126 

Antigen sequence

QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFL
GRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHY
EVLDLKPNGKVASVEMVKYHHCRDVP
 
QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFL
GRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHY
EVLDLKPNGKVASVEMVKYHHCRDVP
 

Matching transcripts

ASNS-001 - ENSP00000377845 [100%]
ASNS-002 - ENSP00000414901 [100%]
ASNS-005 - ENSP00000406994 [100%]
ASNS-006 - ENSP00000408472 [100%]
ASNS-007 - ENSP00000377846 [100%]
ASNS-008 - ENSP00000414379 [100%]
ASNS-009 - ENSP00000401651 [100%]
ASNS-015 - ENSP00000400422 [100%]
ASNS-201 - ENSP00000175506 [100%]
 ASNS-001 - ENSP00000377845 [100%]
ASNS-002 - ENSP00000414901 [100%]
ASNS-005 - ENSP00000406994 [100%]
ASNS-006 - ENSP00000408472 [100%]
ASNS-007 - ENSP00000377846 [100%]
ASNS-008 - ENSP00000414379 [100%]
ASNS-009 - ENSP00000401651 [100%]
ASNS-015 - ENSP00000400422 [100%]
ASNS-201 - ENSP00000175506 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
  

Antibody dilution

1:5  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.4, 62.2, 54.8, 45.6, 24.4 64.4, 62.2, 54.8, 45.6, 24.4 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:35 

Validation IH

 Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
ASNS-001
 
ASNS-002
 
ASNS-005
 
ASNS-006
 
ASNS-007
 
ASNS-008
 
ASNS-009
 
ASNS-015
 
ASNS-201