ATP2B1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011166

 

Antibody HPA012945

 

Antibody CAB005605

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Affinity BioReagents
 

Product name

HPA011166 HPA012945 PA1-914 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

4 4 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

124 90  

Antigen sequence

DYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIIL
KKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAG
EPEPEWDNENDIVTGLTCIAVVGI
 
GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQE
SYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIP
 
 

Matching transcripts

ATP2B1-001 - ENSP00000392043 [100%]
ATP2B1-002 - ENSP00000352054 [100%]
ATP2B1-003 - ENSP00000376869 [100%]
ATP2B1-201 - ENSP00000261173 [100%]
ATP2B1-202 - ENSP00000343599 [100%]
 ATP2B1-001 - ENSP00000392043 [100%]
ATP2B1-002 - ENSP00000352054 [100%]
ATP2B1-201 - ENSP00000261173 [100%]
ATP2B1-202 - ENSP00000343599 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows strong membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:50 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

  Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & plasma membrane.
More information
 

Antibody dilution

  1:25 

Validation IF

  Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

  Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

134.7, 130.6, 129.5, 106.9 134.7, 130.6, 129.5 134.7, 130.6, 129.5, 106.9, 18.5, 11.5 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ATP2B1-001
 
ATP2B1-002
 
ATP2B1-003
 
ATP2B1-201
 
ATP2B1-202