RPS6KA2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045061

 

Antibody HPA054237

 

Antibody CAB026243

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA045061 HPA054237 AF893 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 12 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

51 40  

Antigen sequence

MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEG
F
 
VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK
 
 

Matching transcripts

RPS6KA2-001 - ENSP00000265678 [100%]
 RPS6KA2-001 - ENSP00000265678 [100%]
RPS6KA2-003 - ENSP00000427015 [100%]
RPS6KA2-005 - ENSP00000422435 [100%]
RPS6KA2-006 - ENSP00000422484 [100%]
RPS6KA2-007 - ENSP00000386050 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human rectum shows strong positivity in glandular cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:100 

Validation IH

  Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line HeLa shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line HeLa shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:54 1:60 1:25 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.2 85.6, 84.0, 83.2, 73.1 85.6, 84.0, 83.2, 73.1, 19.2, 18.9, 16.4, 14.6, 11.3, 4.3 

Antibody dilution

1:250 1:300 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:2400  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
RPS6KA2-001
 
RPS6KA2-003
 
RPS6KA2-005
 
RPS6KA2-006
 
RPS6KA2-007