IKBKG

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000426

 

Antibody CAB010373

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA000426 sc-8330 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

119  

Antigen sequence

HLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQR
CLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKL
VERLGLEKLDLKRQKEQAL
 
 

Matching transcripts

IKBKG-002 - ENSP00000358622 [100%]
IKBKG-003 - ENSP00000358620 [100%]
IKBKG-004 - ENSP00000358619 [100%]
IKBKG-005 - ENSP00000358614 [100%]
IKBKG-006 - ENSP00000358615 [100%]
IKBKG-007 - ENSP00000394934 [100%]
IKBKG-008 - ENSP00000390368 [100%]
IKBKG-011 - ENSP00000263518 [100%]
IKBKG-012 - ENSP00000395205 [100%]
IKBKG-014 - ENSP00000420565 [100%]
IKBKG-016 - ENSP00000377180 [100%]
IKBKG-017 - ENSP00000400769 [100%]
IKBKG-009 - ENSP00000398579 [92%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:100 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in cytoplasm.
More information
  

Antibody dilution

1:80  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

55.8, 48.2, 48.1, 47.4, 47.3, 42.4, 37.0, 28.8, 23.7, 22.3, 16.1 55.8, 48.2, 48.1, 47.4, 47.3, 42.4, 37.0, 28.8, 23.7, 22.3, 21.7, 16.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
IKBKG-002
 
IKBKG-003
 
IKBKG-004
 
IKBKG-005
 
IKBKG-006
 
IKBKG-007
 
IKBKG-008
 
IKBKG-009
 
IKBKG-011
 
IKBKG-012
 
IKBKG-014
 
IKBKG-016
 
IKBKG-017
 
 »