CA12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008773

 

Antibody CAB025181

 

Antibody CAB062549

 

Antibody CAB068179

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA008773 MAB2190 AMAb90639 AMAb90637 

Host species

Rabbit Mouse Mouse Mouse 

Clonality

pAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G Protein A/G 

Released in version

3 5 12 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein Recombinant protein 

Length (aa)

120    

Antigen sequence

TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIE
ELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALY
CTHMDDPSPREMINNFRQVQ
 
 
 
 

Matching transcripts

CA12-001 - ENSP00000178638 [100%]
CA12-002 - ENSP00000343088 [100%]
CA12-003 - ENSP00000403028 [100%]
    

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in subset of cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:90 1:250 1:8000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400487)
More information
   Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

39.5, 38.4, 31.9 39.5, 38.4, 31.9 39.5, 38.4, 31.9 39.5, 38.4, 31.9 

Antibody dilution

1:250 1:500 1:500 1:1000 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
CA12-001
 
CA12-002
 
CA12-003