CA12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008773

 

Antibody CAB025181

 

Antibody CAB062549

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 Atlas Antibodies
 

Product name

HPA008773 MAB2190 AMAb90639 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

3 5 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

120   

Antigen sequence

TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIE
ELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALY
CTHMDDPSPREMINNFRQVQ
 
 
 

Matching transcripts

CA12-001 - ENSP00000178638 [100%]
CA12-002 - ENSP00000343088 [100%]
CA12-003 - ENSP00000403028 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
More information
  

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:75 1:90  

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400487)
More information
   

Target mass (kDa)

39.5, 38.4, 31.9 39.5, 38.4, 31.9 39.5, 38.4, 31.9 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
CA12-001
 
CA12-002
 
CA12-003