DPP8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008706

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA008706 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

119 

Antigen sequence

MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLA
DTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYS
EIPKTINRAAVLMLSWKPL
 

Matching transcripts

DPP8-001 - ENSP00000339208 [100%]
DPP8-002 - ENSP00000318111 [100%]
DPP8-003 - ENSP00000351817 [100%]
DPP8-004 - ENSP00000300141 [100%]
DPP8-005 - ENSP00000379013 [100%]
DPP8-011 - ENSP00000453954 [100%]
DPP8-015 - ENSP00000452719 [100%]
DPP8-016 - ENSP00000455592 [100%]
DPP8-201 - ENSP00000316373 [100%]
DPP8-202 - ENSP00000341230 [100%]
DPP8-012 - ENSP00000453870 [87%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:40 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:35 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

103.4, 101.4, 97.7, 97.5, 89.9, 83.9, 83.4, 25.1, 18.9, 14.2 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3090 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
DPP8-001
 
DPP8-002
 
DPP8-003
 
DPP8-004
 
DPP8-005
 
DPP8-011
 
DPP8-012
 
DPP8-015
 
DPP8-016
 
DPP8-201
 
DPP8-202
 
 »