ANO8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA031787

 

Antibody HPA049206

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA031787 HPA049206 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

14 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

95 75 

Antigen sequence

GVLDKLFGKRLLQAGRYLVSHKAWMKTVPTENCDVLMTFPDTTDDHTLLW
LLNHIRVGIPELIVQVRHHRHTRAYAFFVTATYESLLRGADELGL
 
REHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGPERPKRPGSL
LAPNNVMKLKQIIPLQGKFLSSGAT
 

Matching transcripts

ANO8-001 - ENSP00000159087 [100%]
 ANO8-001 - ENSP00000159087 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:60 

Literature conformity

 No avaliable gene/protein characterization data 

RNA consistency

 Not consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:7  

Validation IF

Non-supportive: The subcellular location is not consistent with experimental gene/protein characterization data, or conflicting with an independent antibody.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

136.0 136.0 

Antibody dilution

1:250 1:200 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:1650 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ANO8-001