ACTB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041264

 

Antibody HPA041271

 

Antibody CAB002621

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA041264 HPA041271 RB-9421 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

10 10 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

26 37  

Antigen sequence

PKANREKMTQIMFETFNTPAMYVAIQ
 
MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
 
 

Matching transcripts

ACTB-001 - ENSP00000349960 [100%]
ACTB-008 - ENSP00000407473 [100%]
 ACTB-001 - ENSP00000349960 [100%]
ACTB-002 - ENSP00000409264 [100%]
ACTB-008 - ENSP00000407473 [100%]
ACTB-009 - ENSP00000393951 [100%]
ACTB-010 - ENSP00000401032 [100%]
ACTB-012 - ENSP00000399487 [100%]
  

Other gene match

ACTA2 - ENSG00000107796 [96%]
ACTA1 - ENSG00000143632 [96%]
ACTC1 - ENSG00000159251 [96%]
ACTG2 - ENSG00000163017 [96%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
POTEJ - ENSG00000222038 [100%]
 ACTA2 - ENSG00000107796 [97%]
ACTA1 - ENSG00000143632 [97%]
ACTC1 - ENSG00000159251 [97%]
ACTG2 - ENSG00000163017 [97%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [84%]
POTEF - ENSG00000196604 [84%]
POTEI - ENSG00000196834 [84%]
POTEJ - ENSG00000222038 [84%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1800 1:150 1:400 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

   

Description

  Immunofluorescent staining of human cell line U-251 MG shows no positivity.
More information
 

Antibody dilution

  1:100 

Validation IF

  Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

121.4, 121.3, 117.4, 42.1, 42.0, 41.9, 41.8, 41.7, 37.1, 26.9, 23.8, 18.0, 16.8 121.4, 121.3, 117.4, 42.1, 42.0, 41.9, 41.8, 41.7, 32.3, 26.9, 23.8, 21.8, 18.0, 16.8, 16.3, 14.5, 13.9, 13.0, 11.4, 11.0, 8.5 41.7, 18.0, 13.9, 11.4, 11.0, 8.5 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACTB-001
 
ACTB-002
 
ACTB-008
 
ACTB-009
 
ACTB-010
 
ACTB-012