DLG1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA069593

 

Antibody CAB016307

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA069593 sc-9961 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

14 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

46  

Antigen sequence

TNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPR
 
 

Matching transcripts

DLG1-001 - ENSP00000345731 [100%]
DLG1-007 - ENSP00000391732 [100%]
DLG1-008 - ENSP00000407531 [100%]
DLG1-011 - ENSP00000398939 [100%]
DLG1-013 - ENSP00000376187 [100%]
DLG1-019 - ENSP00000413238 [100%]
DLG1-020 - ENSP00000396658 [100%]
DLG1-021 - ENSP00000398702 [100%]
DLG1-027 - ENSP00000411278 [100%]
DLG1-201 - ENSP00000350303 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:225 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HaCaT shows positivity in plasma membrane & vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:70  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

103.3, 100.5, 99.9, 99.8, 97.1, 95.2, 88.5, 87.2, 30.5 103.3, 100.5, 99.9, 99.8, 97.1, 95.2, 88.5, 87.2, 30.5, 23.3, 20.4, 17.7, 14.3, 13.3, 12.2, 4.4 

Antibody dilution

1:240 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2850  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
DLG1-001
 
DLG1-007
 
DLG1-008
 
DLG1-011
 
DLG1-013
 
DLG1-019
 
DLG1-020
 
DLG1-021
 
DLG1-027
 
DLG1-201