BAZ2A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005782

 

Antibody HPA063806

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005782 HPA063806 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

175 92 

Antigen sequence

QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSRQPSSPSHNTNLRAGS
QEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPML
GSSIQTFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVGSLELEEEQPE
LKMCGYNGSVPSVESLHQEVSVLVP
 
SLEVPLTASVTSPKASPVTSPAAAFPTASPANKDVSSFLETTADVEEITG
EGLTASGSGDVMRRRIATPEEVRLPLQHGWRREVRIKKGSHR
 

Matching transcripts

BAZ2A-001 - ENSP00000446880 [100%]
BAZ2A-003 - ENSP00000447941 [100%]
BAZ2A-002 - ENSP00000368754 [83%]
BAZ2A-201 - ENSP00000179765 [83%]
 BAZ2A-001 - ENSP00000446880 [100%]
BAZ2A-002 - ENSP00000368754 [100%]
BAZ2A-003 - ENSP00000447941 [100%]
BAZ2A-201 - ENSP00000179765 [100%]
BAZ2A-009 - ENSP00000447591 [86%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in subsets of seminiferous duct cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:20  

Literature conformity

Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

211.2, 210.9, 208.1, 207.8 211.2, 210.9, 208.1, 207.8, 28.8 

Antibody dilution

1:250 1:1230 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:14750 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line SiHa shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:200 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
BAZ2A-001
 
BAZ2A-002
 
BAZ2A-003
 
BAZ2A-009
 
BAZ2A-201