TOP2B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024120

 

Antibody HPA050441

 

Antibody CAB004601

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA024120 HPA050441 sc-25330 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

5 12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

143 138  

Antigen sequence

LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEET
MPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPV
EGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
 
DKVPSKTVAAKKGKPSSDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKT
TTPKGKGRGAKKRKASGSENEGDYNPGRKTSKTTSKKPKKTSFDQDSDVD
IFPSDFPTEPPSLPRTGRARKEVKYFAESDEEEDDVDF
 
 

Matching transcripts

TOP2B-001 - ENSP00000396704 [100%]
TOP2B-201 - ENSP00000264331 [100%]
TOP2B-202 - ENSP00000437352 [100%]
TOP2B-203 - ENSP00000446023 [100%]
 TOP2B-001 - ENSP00000396704 [100%]
TOP2B-201 - ENSP00000264331 [100%]
TOP2B-202 - ENSP00000437352 [100%]
TOP2B-203 - ENSP00000446023 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
More information
  Immunohistochemical staining of human pancreas shows strong nuclear positivity.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:300  1:100 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data  Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus.
More information
 

Antibody dilution

1:100 1:64 1:25 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

183.3, 182.7, 53.0 183.3, 182.7, 53.0 183.3, 182.7, 130.5, 53.0, 8.2 

Antibody dilution

1:250 1:320 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:4000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
TOP2B-001
 
TOP2B-201
 
TOP2B-202
 
TOP2B-203