PAK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044791

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044791 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

51 

Antigen sequence

KFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEE
E
 

Matching transcripts

PAK3-001 - ENSP00000361077 [100%]
PAK3-002 - ENSP00000361080 [100%]
PAK3-006 - ENSP00000429113 [100%]
PAK3-007 - ENSP00000428921 [100%]
PAK3-201 - ENSP00000262836 [100%]
PAK3-202 - ENSP00000353864 [100%]
PAK3-203 - ENSP00000389172 [100%]
PAK3-204 - ENSP00000401982 [100%]
PAK3-205 - ENSP00000410853 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:125 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.5, 62.9, 62.3, 60.7 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PAK3-001
 
PAK3-002
 
PAK3-006
 
PAK3-007
 
PAK3-201
 
PAK3-202
 
PAK3-203
 
PAK3-204
 
PAK3-205