ACTN2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA006035

 

Antibody HPA008315

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA006035 HPA008315 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

121 142 

Antigen sequence

SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYG
KLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSS
FYHAFSGAQKAETAANRICKV
 
AHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDE
LRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNK
MEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGD
 

Matching transcripts

ACTN2-201 - ENSP00000443495 [83%]
ACTN2-001 - ENSP00000355537 [82%]
 ACTN2-001 - ENSP00000355537 [100%]
ACTN2-201 - ENSP00000443495 [100%]
ACTN2-202 - ENSP00000438384 [100%]
 

Other gene match

ACTN1 - ENSG00000072110 [100%]
ACTN4 - ENSG00000130402 [93%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:350 1:35 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data for all of the genes Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoskeleton (actin filaments).
More information
 Immunofluorescent staining of human cell line U-251 MG shows no positivity.
More information
 

Antibody dilution

1:20 1:286 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

107.1, 105.6, 104.9, 103.9, 103.1, 102.7, 94.8, 29.6, 27.1 103.9, 44.6 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ACTN2-001
 
ACTN2-201
 
ACTN2-202